Recombinant Human EMP3

Cat.No. : EMP3-28552TH
Product Overview : Recombinant fragment of Human EMP3 with N-terminal proprietary tag. Predicted MW 30.47 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 44 amino acids
Description : Epithelial membrane protein 3 is a protein that in humans is encoded by the EMP3 gene.
Molecular Weight : 30.470kDa
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV
Sequence Similarities : Belongs to the PMP-22/EMP/MP20 family.
Gene Name EMP3 epithelial membrane protein 3 [ Homo sapiens ]
Official Symbol EMP3
Synonyms EMP3; epithelial membrane protein 3; YMP;
Gene ID 2014
mRNA Refseq NM_001425
Protein Refseq NP_001416
MIM 602335
Uniprot ID P54852
Chromosome Location 19q13.3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EMP3 Products

Required fields are marked with *

My Review for All EMP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon