Recombinant Human ELK4 Protein, GST-tagged
Cat.No. : | ELK4-3246H |
Product Overview : | Human ELK4 full-length ORF ( NP_068567.1, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 71.1 kDa |
AA Sequence : | MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELK4 ELK4, ETS-domain protein (SRF accessory protein 1) [ Homo sapiens ] |
Official Symbol | ELK4 |
Synonyms | ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1; SAP-1; serum response factor accessory protein 1; DKFZp434N185; |
Gene ID | 2005 |
mRNA Refseq | NM_001973 |
Protein Refseq | NP_001964 |
MIM | 600246 |
UniProt ID | P28324 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ELK4 Products
Required fields are marked with *
My Review for All ELK4 Products
Required fields are marked with *
0
Inquiry Basket