Recombinant Full Length Human ELK4 Protein, GST-tagged

• Cat.No.: ELK4-4354HF
• Product Overview: Human ELK4 full-length ORF ( NP_068567.1, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 71.1 kDa
• Protein length: 405 amino acids
• AA Sequence: MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELK4 ELK4, ETS-domain protein (SRF accessory protein 1) [ Homo sapiens ]
• Official Symbol: ELK4
• Synonyms: ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1; SAP-1; serum response factor accessory protein 1; DKFZp434N185
• Gene ID: 2005
• mRNA Refseq: NM_001973
• Protein Refseq: NP_001964
• MIM: 600246
• UniProt ID: P28324