Recombinant Human ELANE Protein, GST-tagged

Cat.No. : ELANE-3222H
Product Overview : Human ELA2 partial ORF ( NP_001963, 168 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode structurally similar proteins. The encoded preproprotein is proteolytically processed to generate the active protease. Following activation, this protease hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix. The enzyme may play a role in degenerative and inflammatory diseases through proteolysis of collagen-IV and elastin. This protein also degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is present in a gene cluster on chromosome 19. [provided by RefSeq, Jan 2016]
Molecular Mass : 36.74 kDa
AA Sequence : VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELANE elastase, neutrophil expressed [ Homo sapiens (human) ]
Official Symbol ELANE
Synonyms ELANE; elastase, neutrophil expressed; Elastase, Neutrophil Expressed; Medullasin 2; Bone Marrow Serine Protease; Elastase 2, Neutrophil; Neutrophil Elastase; Leukocyte Elastase; PMN Elastase; Elastase-2; ELA2; HLE; Granulocyte-Derived Elastase; Polymorphonuclear Elastase; Human Leukocyte Elastase; EC 3.4.21.37; EC 3.4.21; PMN-E; SCN1; HNE; GE; NE; neutrophil elastase; PMN elastase; bone marrow serine protease; elastase 2, neutrophil; elastase-2; granulocyte-derived elastase; leukocyte elastase; medullasin; polymorphonuclear elastase
Gene ID 1991
mRNA Refseq NM_001972
Protein Refseq NP_001963
MIM 130130
UniProt ID P08246

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ELANE Products

Required fields are marked with *

My Review for All ELANE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon