Recombinant Human EIF5A2 Protein, GST-tagged

Cat.No. : EIF5A2-3215H
Product Overview : Human EIF5A2 full-length ORF ( AAH36072, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EIF5A2 (Eukaryotic Translation Initiation Factor 5A2) is a Protein Coding gene. Among its related pathways are Gamma carboxylation, hypusine formation and arylsulfatase activation and Metabolism of proteins. GO annotations related to this gene include RNA binding and translation elongation factor activity. An important paralog of this gene is EIF5A.
Molecular Mass : 42.46 kDa
AA Sequence : MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ]
Official Symbol EIF5A2
Synonyms EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2; eIF-5A-2; eukaryotic initiation factor 5A; EIF-5A2; eIF5AII;
Gene ID 56648
mRNA Refseq NM_020390
Protein Refseq NP_065123
MIM 605782
UniProt ID Q9GZV4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF5A2 Products

Required fields are marked with *

My Review for All EIF5A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon