Recombinant Full Length Human EIF5A2 Protein, GST-tagged

• Cat.No.: EIF5A2-4301HF
• Product Overview: Human EIF5A2 full-length ORF ( AAH36072, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 153 amino acids
• Description: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2) is a Protein Coding gene. Among its related pathways are Gamma carboxylation, hypusine formation and arylsulfatase activation and Metabolism of proteins. GO annotations related to this gene include RNA binding and translation elongation factor activity. An important paralog of this gene is EIF5A.
• Molecular Mass: 42.46 kDa
• AA Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ]
• Official Symbol: EIF5A2
• Synonyms: EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2; eIF-5A-2; eukaryotic initiation factor 5A; EIF-5A2; eIF5AII
• Gene ID: 56648
• mRNA Refseq: NM_020390
• Protein Refseq: NP_065123
• MIM: 605782
• UniProt ID: Q9GZV4