Recombinant Human EGR2

• Cat.No.: EGR2-28469TH
• Product Overview: Recombinant fragment corresponding to amino acids 217-293 of Human EGR2 with an N terminal proprietary tag; Predicted MWt 34.10 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 77 amino acids
• Description: The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.
• Molecular Weight: 34.100kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
• Sequence Similarities: Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.

Gene Information

• Gene Name: EGR2 early growth response 2 [ Homo sapiens ]
• Official Symbol: EGR2
• Synonyms: EGR2; early growth response 2; early growth response 2 (Krox 20 homolog, Drosophila) , KROX20; early growth response protein 2; Krox 20 homolog; Drosophila
• Gene ID: 1959
• mRNA Refseq: NM_001136178
• Protein Refseq: NP_001129650
• MIM: 129010
• Uniprot ID: P11161
• Chromosome Location: 10q21.1
• Pathway: Adipogenesis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: DNA binding; RNA polymerase II activating transcription factor binding; chromatin binding; metal ion binding; protein binding