Recombinant Human EGFL7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EGFL7-1694H
• Product Overview: EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 29.4 kDa
• AA Sequence: MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ]
• Official Symbol: EGFL7
• Synonyms: EGFL7; EGF-like-domain, multiple 7; epidermal growth factor-like protein 7; ZNEU1; EGF-like protein 7; NOTCH4-like protein; vascular endothelial statin; multiple EGF-like domains protein 7; multiple epidermal growth factor-like domains protein 7; NEU1; VE-STATIN; RP11-251M1.2; MGC111117
• Gene ID: 51162
• mRNA Refseq: NM_016215
• Protein Refseq: NP_057299
• MIM: 608582
• UniProt ID: Q9UHF1