Recombinant Human EGFL7 Protein, His tagged

• Cat.No.: EGFL7-001H
• Product Overview: Recombinant Human EGFL7 Protein (21-273 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Non
• Protein Length: 21-273 aa
• Description: This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 29 kDa
• Purity: > 90% by SDS-PAGE
• AA Sequence: MEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSHHHHHHHH
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH6.5, 10% Glycerol, 8% Trehalose
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ]
• Official Symbol: EGFL7
• Synonyms: EGFL7; EGF-like-domain, multiple 7; epidermal growth factor-like protein 7; ZNEU1; EGF-like protein 7; NOTCH4-like protein; vascular endothelial statin; multiple EGF-like domains protein 7; multiple epidermal growth factor-like domains protein 7; NEU1; VE-STATIN; RP11-251M1.2; MGC111117
• Gene ID: 51162
• mRNA Refseq: NM_016215
• Protein Refseq: NP_057299
• MIM: 608582
• UniProt ID: Q9UHF1