Recombinant Human EFNB1 Protein, hIgG-His-tagged

• Cat.No.: EFNB1-001H
• Product Overview: Recombinant human EFNB1 protein(28-237aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: Fc&His
• Protein Length: 28-237 a.a.
• Description: EFNB1, also known as ephrin-B1, is a member of Eph family. It binds to the receptor tyrosine kinases EPHB1 and EPHA1. This protein also binds Eph receptors residing on adjacent cells which affect signaling to neighboring cells. It plays a role in cellular migration, axon guidance, osteoclast differentiation and function, cardiac muscle morphogenesis, and tumorigenesis.
• Form: Liquid
• Molecular Mass: 50.3 kDa
• N-terminal Sequence Analysis: Ala
• Endotoxin: < 0.1 EU per 1μg of protein (determined by LAL method)
• Purity: > 90% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1.0 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
• Warning: For research use only. This product is not intended or approved for human, diagnostics or veterin
• AA Sequence: ADPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH

Gene Information

• Gene Name: EFNB1 ephrin B1 [ Homo sapiens (human) ]
• Official Symbol: EFNB1
• Synonyms: EFNB1; ephrin B1; CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2
• Gene ID: 1947
• mRNA Refseq: NM_004429
• Protein Refseq: NP_004420
• MIM: 300035
• UniProt ID: P98172