Recombinant Human EFNB1 protein, GST-tagged

• Cat.No.: EFNB1-301454H
• Product Overview: Recombinant Human EFNB1 (32-239 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Leu32-Ala239
• AA Sequence: LEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: EFNB1 ephrin-B1 [ Homo sapiens ]
• Official Symbol: EFNB1
• Synonyms: EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia) , EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782
• Gene ID: 1947
• mRNA Refseq: NM_004429
• Protein Refseq: NP_004420
• MIM: 300035
• UniProt ID: P98172