Recombinant Human EDA2R Protein, GST-tagged
Cat.No. : | EDA2R-3045H |
Product Overview : | Human EDA2R full-length ORF ( NP_068555.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains cysteine-rich repeats and a single transmembrane domain. This protein binds to the EDA-A2 isoform of ectodysplasin, which plays an important role in maintenance of hair and teeth. Alternatively spliced transcript variants encodes distinct protein isoforms. [provided by RefSeq, Apr 2016] |
Molecular Mass : | 59.1 kDa |
AA Sequence : | MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EDA2R ectodysplasin A2 receptor [ Homo sapiens ] |
Official Symbol | EDA2R |
Synonyms | EDA2R; ectodysplasin A2 receptor; tumor necrosis factor receptor superfamily member 27; EDA A2R; EDAA2R; TNFRSF27; XEDAR; EDA-A2 receptor; X-linked ectodysplasin-A2 receptor; tumor necrosis factor receptor superfamily member XEDAR; EDA-A2R; |
Gene ID | 60401 |
mRNA Refseq | NM_001199687 |
Protein Refseq | NP_001186616 |
MIM | 300276 |
UniProt ID | Q9HAV5 |
◆ Recombinant Proteins | ||
EDA2R-4393H | Recombinant Human EDA2R Protein, His (Fc)-Avi-tagged | +Inquiry |
Eda2r-7461R | Recombinant Rat Eda2r protein(Met2-Glu137), His-tagged | +Inquiry |
EDA2R-132H | Recombinant Human EDA2R protein, hIgG/His-tagged | +Inquiry |
Eda2r-7460R | Recombinant Rat Eda2r protein(Met2-Glu137), hFc-tagged | +Inquiry |
EDA2R-1701H | Recombinant Human Ectodysplasin A2 Receptor, Fc Chimera | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDA2R-2021HCL | Recombinant Human EDA2R cell lysate | +Inquiry |
EDA2R-1335MCL | Recombinant Mouse EDA2R cell lysate | +Inquiry |
EDA2R-990CCL | Recombinant Cynomolgus EDA2R cell lysate | +Inquiry |
EDA2R-1410RCL | Recombinant Rat EDA2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDA2R Products
Required fields are marked with *
My Review for All EDA2R Products
Required fields are marked with *
0
Inquiry Basket