Recombinant Human ECE1 protein, His-tagged

• Cat.No.: ECE1-3668H
• Product Overview: Recombinant Human ECE1 protein(90-189 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 90-189 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNET
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ECE1 endothelin converting enzyme 1 [ Homo sapiens ]
• Official Symbol: ECE1
• Synonyms: ECE1; endothelin converting enzyme 1; ECE; endothelin-converting enzyme 1; ECE-1
• Gene ID: 1889
• mRNA Refseq: NM_001113347
• Protein Refseq: NP_001106818
• MIM: 600423
• UniProt ID: P42892