Recombinant Human E2F2 Protein, GST-tagged

Cat.No. : E2F2-3004H
Product Overview : Human E2F2 full-length ORF ( AAH07609, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.87 kDa
AA Sequence : MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name E2F2 E2F transcription factor 2 [ Homo sapiens ]
Official Symbol E2F2
Synonyms E2F2; E2F transcription factor 2; transcription factor E2F2; E2F 2; E2F-2;
Gene ID 1870
mRNA Refseq NM_004091
Protein Refseq NP_004082
MIM 600426
UniProt ID Q14209

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All E2F2 Products

Required fields are marked with *

My Review for All E2F2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon