Recombinant Full Length Human E2F2 Protein, GST-tagged
Cat.No. : | E2F2-4111HF |
Product Overview : | Human E2F2 full-length ORF ( AAH07609, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 83 amino acids |
Description : | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.87 kDa |
AA Sequence : | MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | E2F2 E2F transcription factor 2 [ Homo sapiens ] |
Official Symbol | E2F2 |
Synonyms | E2F2; E2F transcription factor 2; transcription factor E2F2; E2F 2; E2F-2; |
Gene ID | 1870 |
mRNA Refseq | NM_004091 |
Protein Refseq | NP_004082 |
MIM | 600426 |
UniProt ID | Q14209 |
◆ Recombinant Proteins | ||
E2F2-4111HF | Recombinant Full Length Human E2F2 Protein, GST-tagged | +Inquiry |
E2F2-2017H | Recombinant Human E2F2 Protein (Arg129-Tyr429), N-His tagged | +Inquiry |
E2F2-133HF | Recombinant Full Length Human E2F2 Protein | +Inquiry |
E2F2-3004H | Recombinant Human E2F2 Protein, GST-tagged | +Inquiry |
E2F2-1635H | Recombinant Human E2F2 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F2-520HCL | Recombinant Human E2F2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All E2F2 Products
Required fields are marked with *
My Review for All E2F2 Products
Required fields are marked with *
0
Inquiry Basket