Recombinant Human E2F2

• Cat.No.: E2F2-27376TH
• Product Overview: Recombinant full length Human E2F2 with N terminal proprietary tag; Predicted MWt 35.24 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 83 amino acids
• Description: The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.
• Molecular Weight: 35.240kDa inclusive of tags
• Tissue specificity: Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
• Sequence Similarities: Belongs to the E2F/DP family.

Gene Information

• Gene Name: E2F2 E2F transcription factor 2 [ Homo sapiens ]
• Official Symbol: E2F2
• Synonyms: E2F2; E2F transcription factor 2; transcription factor E2F2; E2F 2
• Gene ID: 1870
• mRNA Refseq: NM_004091
• Protein Refseq: NP_004082
• MIM: 600426
• Uniprot ID: Q14209
• Chromosome Location: 1p36
• Pathway: Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; CDC6 association with the ORC:origin complex, organism-specific biosystem
• Function: DNA binding; core promoter binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription factor binding