Recombinant Human DYNLRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DYNLRB1-1114H
Product Overview : DYNLRB1 MS Standard C13 and N15-labeled recombinant protein (NP_054902) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18.
Molecular Mass : 10.9 kDa
AA Sequence : MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DYNLRB1 dynein light chain roadblock-type 1 [ Homo sapiens (human) ]
Official Symbol DYNLRB1
Synonyms DYNLRB1; dynein, light chain, roadblock-type 1; DNCL2A, dynein, cytoplasmic, light polypeptide 2A; dynein light chain roadblock-type 1; DNLC2A; roadblock domain containing 1; ROBLD1; Roadblock-1; ROBL/LC7-like 1; bithoraxoid-like protein; dynein-associated protein Km23; dynein-associated protein HKM23; cytoplasmic dynein light chain 2A; dynein light chain 2A, cytoplasmic; roadblock domain-containing protein 1; dynein, cytoplasmic, light polypeptide 2A; BLP; BITH; DNCL2A;
Gene ID 83658
mRNA Refseq NM_014183
Protein Refseq NP_054902
MIM 607167
UniProt ID Q9NP97

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DYNLRB1 Products

Required fields are marked with *

My Review for All DYNLRB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon