Recombinant Human DYNLRB1 protein, His-tagged
Cat.No. : | DYNLRB1-273H |
Product Overview : | Recombinant Human DYNLRB1(1 - 96 aa) fused with His tag at N-terminal was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 96 aa |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
AA Sequence : | MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKK NEIMVAPDKDYFLIVIQNPTE |
Purity : | > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | DYNLRB1 dynein, light chain, roadblock-type 1 [ Homo sapiens ] |
Official Symbol | DYNLRB1 |
Synonyms | DYNLRB1; dynein, light chain, roadblock-type 1; DNCL2A, dynein, cytoplasmic, light polypeptide 2A; dynein light chain roadblock-type 1; DNLC2A; roadblock domain containing 1; ROBLD1; Roadblock-1; ROBL/LC7-like 1; bithoraxoid-like protein; dynein-associated protein Km23; dynein-associated protein HKM23; cytoplasmic dynein light chain 2A; dynein light chain 2A, cytoplasmic; roadblock domain-containing protein 1; dynein, cytoplasmic, light polypeptide 2A; BLP; BITH; DNCL2A; |
Gene ID | 83658 |
mRNA Refseq | NM_014183 |
Protein Refseq | NP_054902 |
MIM | 607167 |
UniProt ID | Q9NP97 |
Chromosome Location | 20q11.21 |
Pathway | TGF-beta receptor signaling, organism-specific biosystem; |
Function | identical protein binding; microtubule motor activity; protein binding; |
◆ Recombinant Proteins | ||
DYNLRB1-2584M | Recombinant Mouse DYNLRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYNLRB1-4800H | Recombinant Human DYNLRB1 protein, His-SUMO-tagged | +Inquiry |
DYNLRB1-1114H | Recombinant Human DYNLRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dynlrb1-2700M | Recombinant Mouse Dynlrb1 Protein, Myc/DDK-tagged | +Inquiry |
DYNLRB1-2976H | Recombinant Human DYNLRB1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLRB1-6755HCL | Recombinant Human DYNLRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYNLRB1 Products
Required fields are marked with *
My Review for All DYNLRB1 Products
Required fields are marked with *
0
Inquiry Basket