Recombinant Human DUSP3, His-tagged
Cat.No. : | DUSP3-26911TH |
Product Overview : | Recombinant full-length Human DUSP3 with a N terminal His tag; 205aa, 23 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 205 amino acids |
Description : | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. |
Conjugation : | HIS |
Molecular Weight : | 23.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP |
Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
Gene Name | DUSP3 dual specificity phosphatase 3 [ Homo sapiens ] |
Official Symbol | DUSP3 |
Synonyms | DUSP3; dual specificity phosphatase 3; vaccinia virus phosphatase VH1 related , VHR; dual specificity protein phosphatase 3; |
Gene ID | 1845 |
mRNA Refseq | NM_004090 |
Protein Refseq | NP_004081 |
MIM | 600183 |
Uniprot ID | P51452 |
Chromosome Location | 17q21 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; ERK/MAPK targets, organism-specific biosystem; ERKs are inactivated, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; |
Function | MAP kinase phosphatase activity; hydrolase activity; phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; |
◆ Recombinant Proteins | ||
DUSP3-3807H | Recombinant Human DUSP3 protein(Met1-Pro185), His&GST-tagged | +Inquiry |
DUSP3-473H | Recombinant Human DUSP3, Gly & Pro tagged | +Inquiry |
DUSP3-1207H | Active Recombinant Human Dual Specificity Phosphatase 3 | +Inquiry |
DUSP3-2939H | Recombinant Human DUSP3 Protein, GST-tagged | +Inquiry |
Dusp3-2689M | Recombinant Mouse Dusp3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP3-001HCL | Recombinant Human DUSP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP3 Products
Required fields are marked with *
My Review for All DUSP3 Products
Required fields are marked with *
0
Inquiry Basket