Recombinant Human DUSP3 Protein, GST-tagged

• Cat.No.: DUSP3-2939H
• Product Overview: Human DUSP3 full-length ORF ( AAH35701, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. [provided by RefSeq, Jul 2008]
• Molecular Mass: 41.58 kDa
• AA Sequence: MSVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP3 dual specificity phosphatase 3 [ Homo sapiens ]
• Official Symbol: DUSP3
• Synonyms: DUSP3; dual specificity phosphatase 3; vaccinia virus phosphatase VH1 related , VHR; dual specificity protein phosphatase 3; vaccinia H1-related phosphatase; vaccinia virus phosphatase VH1-related; dual specificity protein phosphatase VHR; serine/threonine specific protein phosphatase; VHR
• Gene ID: 1845
• mRNA Refseq: NM_004090
• Protein Refseq: NP_004081
• MIM: 600183
• UniProt ID: P51452