Recombinant Human DUSP28 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DUSP28-5241H
• Product Overview: DUSP28 MS Standard C13 and N15-labeled recombinant protein (NP_001028747) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: DUSP28 (Dual Specificity Phosphatase 28) is a Protein Coding gene. Diseases associated with DUSP28 include Sveinsson Chorioretinal Atrophy. Gene Ontology (GO) annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is SSH3.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 18.3 kDa
• AA Sequence: MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DUSP28 dual specificity phosphatase 28 [ Homo sapiens (human) ]
• Official Symbol: DUSP28
• Synonyms: DUSP28; dual specificity phosphatase 28; DUSP26; VHP
• Gene ID: 285193
• mRNA Refseq: NM_001033575
• Protein Refseq: NP_001028747
• UniProt ID: Q4G0W2