Recombinant Human DPT protein, T7/His-tagged
| Cat.No. : | DPT-66H |
| Product Overview : | Recombinant human Dermatopontin (DPT) gene cDNA (19 - 201aa, derived from BC033736) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His&T7 |
| Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIF SKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKR CPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro DPT mediated TGFb activity for various cell differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for DPT protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential biomarker protein for cancer diagnosis, such as for human oral cancer.5. May be used for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Protein length : | 19-201 a.a. |
| Gene Name | DPT dermatopontin [ Homo sapiens ] |
| Official Symbol | DPT |
| Synonyms | DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP; |
| Gene ID | 1805 |
| mRNA Refseq | NM_001937 |
| Protein Refseq | NP_001928 |
| MIM | 125597 |
| UniProt ID | Q07507 |
| Chromosome Location | 1q12-q23 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPT Products
Required fields are marked with *
My Review for All DPT Products
Required fields are marked with *
0
Inquiry Basket
