Recombinant Human DPT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DPT-4784H |
Product Overview : | DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. |
Molecular Mass : | 24 kDa |
AA Sequence : | MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DPT dermatopontin [ Homo sapiens (human) ] |
Official Symbol | DPT |
Synonyms | DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP; |
Gene ID | 1805 |
mRNA Refseq | NM_001937 |
Protein Refseq | NP_001928 |
MIM | 125597 |
UniProt ID | Q07507 |
◆ Recombinant Proteins | ||
DPT-1754HFL | Recombinant Full Length Human DPT Protein, C-Flag-tagged | +Inquiry |
DPT-673H | Recombinant Human DPT Protein, His-tagged | +Inquiry |
DPT-322H | Active Recombinant Human DPT, His-tagged | +Inquiry |
DPT-4156HF | Recombinant Full Length Human DPT Protein, GST-tagged | +Inquiry |
DPT-66H | Recombinant Human DPT protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPT Products
Required fields are marked with *
My Review for All DPT Products
Required fields are marked with *
0
Inquiry Basket