Recombinant Human DPT Protein, Fc/His-tagged

• Cat.No.: DPT-199H
• Product Overview: Recombinant Human DPT fused with Fc/His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin.
• Source: HEK293 cells
• Tag: His&Fc
• Form: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Molecular Mass: 50kD
• AA Sequence: QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: DPT dermatopontin [ Homo sapiens ]
• Official Symbol: DPT
• Synonyms: DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP
• Gene ID: 1805
• mRNA Refseq: NM_001937
• Protein Refseq: NP_001928
• MIM: 125597
• UniProt ID: Q07507