Recombinant Human DOCK1
Cat.No. : | DOCK1-26153TH |
Product Overview : | Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 152 amino acids |
Description : | This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. |
Molecular Weight : | 42.790kDa inclusive of tags |
Tissue specificity : | Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC |
Sequence Similarities : | Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain. |
Gene Name | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
Official Symbol | DOCK1 |
Synonyms | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK; |
Gene ID | 1793 |
mRNA Refseq | NM_001380 |
Protein Refseq | NP_001371 |
MIM | 601403 |
Uniprot ID | Q14185 |
Chromosome Location | 10q26.13-q26.3 |
Pathway | Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity; |
◆ Recombinant Proteins | ||
DOCK1-401H | Recombinant Human DOCK1 Protein, His-tagged | +Inquiry |
DOCK1-126HF | Recombinant Full Length Human DOCK1 Protein | +Inquiry |
DOCK1-4068HF | Recombinant Full Length Human DOCK1 Protein, GST-tagged | +Inquiry |
DOCK1-2543H | Recombinant Human DOCK1 protein, His-tagged | +Inquiry |
DOCK1-2802H | Recombinant Human DOCK1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK1 Products
Required fields are marked with *
My Review for All DOCK1 Products
Required fields are marked with *
0
Inquiry Basket