Recombinant Human DHX9

• Cat.No.: DHX9-30765TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1-90 of Human RNA Helicase A, with an N-terminal proprietary tag, predicted MWt 35.53 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
• Sequence Similarities: Belongs to the DEAD box helicase family. DEAH subfamily.Contains 2 DRBM (double-stranded RNA-binding) domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.

Gene Information

• Gene Name: DHX9 DEAH (Asp-Glu-Ala-His) box polypeptide 9 [ Homo sapiens ]
• Official Symbol: DHX9
• Synonyms: DHX9; DEAH (Asp-Glu-Ala-His) box polypeptide 9; DDX9, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNA helicase II; leukophysin) , LKP; ATP-dependent RNA helicase A; NDH II; RHA
• Gene ID: 1660
• mRNA Refseq: NM_001357
• Protein Refseq: NP_001348
• MIM: 603115
• Uniprot ID: Q08211
• Chromosome Location: 1q25
• Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem
• Function: ATP binding; ATP-dependent DNA helicase activity; ATP-dependent RNA helicase activity; DNA binding; RNA helicase activity