Recombinant Human DHX9 protein, GST-tagged

• Cat.No.: DHX9-631H
• Product Overview: Recombinant Human DHX9(1 a.a. - 90 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 90 a.a.
• Description: This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.64 kDa
• AA Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: DHX9 DEAH (Asp-Glu-Ala-His) box polypeptide 9 [ Homo sapiens ]
• Official Symbol: DHX9
• Synonyms: DHX9; DEAH (Asp-Glu-Ala-His) box polypeptide 9; DDX9, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNA helicase II; leukophysin) , LKP; ATP-dependent RNA helicase A; NDH II; RHA; leukophysin; DEAH box protein 9; nuclear DNA helicase II; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9; LKP; DDX9; NDH2; NDHII; FLJ17406
• Gene ID: 1660
• mRNA Refseq: NM_001357
• Protein Refseq: NP_001348
• MIM: 603115
• UniProt ID: Q08211
• Chromosome Location: 1q25
• Pathway: Gene expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Splicing, organism-specific biosystem; mRNA Splicing - Major Pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
• Function: ATP binding; ATP-dependent DNA helicase activity; ATP-dependent RNA helicase activity; DNA binding; RNA helicase activity; RNA polymerase II transcription factor binding; double-stranded RNA binding; hydrolase activity; nucleotide binding; protein binding