Recombinant Human DERL3 Protein, GST-tagged
Cat.No. : | DERL3-2548H |
Product Overview : | Human DERL3 full-length ORF ( NP_940842.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DERL3 Der1-like domain family, member 3 [ Homo sapiens ] |
Official Symbol | DERL3 |
Synonyms | DERL3; Der1-like domain family, member 3; C22orf14, chromosome 22 open reading frame 14; derlin-3; derlin 3; FLJ43842; IZP6; MGC71803; DERtrin 3; DERtrin-3; der1-like protein 3; degradation in endoplasmic reticulum protein 3; LLN2; C22orf14; |
Gene ID | 91319 |
mRNA Refseq | NM_001002862 |
Protein Refseq | NP_001002862 |
MIM | 610305 |
UniProt ID | Q96Q80 |
◆ Recombinant Proteins | ||
RFL7736HF | Recombinant Full Length Human Derlin-3(Derl3) Protein, His-Tagged | +Inquiry |
DERL3-4652C | Recombinant Chicken DERL3 | +Inquiry |
DERL3-2548H | Recombinant Human DERL3 Protein, GST-tagged | +Inquiry |
RFL25602BF | Recombinant Full Length Bovine Derlin-3(Derl3) Protein, His-Tagged | +Inquiry |
DERL3-2475HF | Recombinant Full Length Human DERL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DERL3-224HCL | Recombinant Human DERL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DERL3 Products
Required fields are marked with *
My Review for All DERL3 Products
Required fields are marked with *
0
Inquiry Basket