Recombinant Full Length Human DERL3 Protein, GST-tagged

• Cat.No.: DERL3-2475HF
• Product Overview: Human DERL3 full-length ORF ( NP_940842.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 49.8 kDa
• Protein length: 205 amino acids
• AA Sequence: MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DERL3 Der1-like domain family, member 3 [ Homo sapiens ]
• Official Symbol: DERL3
• Synonyms: DERL3; Der1-like domain family, member 3; C22orf14, chromosome 22 open reading frame 14; derlin-3; derlin 3; FLJ43842; IZP6; MGC71803; DERtrin 3; DERtrin-3; der1-like protein 3; degradation in endoplasmic reticulum protein 3; LLN2; C22orf14
• Gene ID: 91319
• mRNA Refseq: NM_001002862
• Protein Refseq: NP_001002862
• MIM: 610305
• UniProt ID: Q96Q80