Recombinant Human DECR1, His-tagged

• Cat.No.: DECR1-972H
• Product Overview: Recombinanthuman DECR1 with his tag was expressed in E.coli and purified by conventional chromatography, 34.4 kDa(35 a.a. - 335 a.a.).

Specification

• Cat. No.: DECR1-972H
• Description: This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters.
• Source: E.coli
• Species: Human
• Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNK VHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAK AGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDL RKVTKEQWDTIEELIRKTKGS
• Form: Liquid
• Concentration: 1 mg/mL
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• StorageBuffer: In 20 mM Tris-HCl, pH 8.0(10% glycerol, 1 mMdithiothreitol)
• Storage: Store at4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot toavoid repeated freezing and thawing.
• OfficialSymbol: DECR1
• Protein length: 35-335 a.a.

Gene Information

• Gene Name: DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens]
• Synonyms: DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH]
• Gene ID: 1666
• mRNA Refseq: NM_001359
• Protein Refseq: NP_001350
• MIM: 222745
• UniProt ID: Q16698
• Chromosome Location: 8q21.3
• Pathway: Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid
• Function: 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding