Recombinant Human DCC protein(1131-1200 aa), C-His-tagged
Cat.No. : | DCC-2762H |
Product Overview : | Recombinant Human DCC protein(P43146)(1131-1200 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1131-1200 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS |
Gene Name | DCC deleted in colorectal carcinoma [ Homo sapiens ] |
Official Symbol | DCC |
Synonyms | DCC; deleted in colorectal carcinoma; netrin receptor DCC; IGDCC1; immunoglobulin superfamily; DCC subclass; member 1; colorectal tumor suppressor; colorectal cancer suppressor; tumor suppressor protein DCC; deleted in colorectal cancer protein; immunoglobulin superfamily DCC subclass member 1; immunoglobulin superfamily, DCC subclass, member 1; CRC18; CRCR1; |
Gene ID | 1630 |
mRNA Refseq | NM_005215 |
Protein Refseq | NP_005206 |
MIM | 120470 |
UniProt ID | P43146 |
◆ Recombinant Proteins | ||
DCC-2762H | Recombinant Human DCC protein(1131-1200 aa), C-His-tagged | +Inquiry |
DCC-2108H | Recombinant Human DCC protein, Fc-tagged | +Inquiry |
DCC-4344M | Recombinant Mouse DCC Protein | +Inquiry |
Dcc-2470M | Recombinant Mouse Dcc Protein, Myc/DDK-tagged | +Inquiry |
DCC-2110H | Recombinant Human Deleted In Colorectal Carcinoma, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCC Products
Required fields are marked with *
My Review for All DCC Products
Required fields are marked with *
0
Inquiry Basket