Recombinant Human DCANP1 Protein, GST-Tagged

• Cat.No.: DCANP1-0082H
• Product Overview: Human DCANP1 full-length ORF (NP_570900.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This intronless gene is specifically expressed in dendritic cells (DCs), which are potent antigen-presenting cells involved in activating naive T cells to initiate antigen-specific immune response. The encoded protein is localized mainly in the perinucleus. One of the alleles (A/T) of this gene, that causes premature translation termination at aa 117, has been associated with an increased prevalence of major depression in humans. [provided by RefSeq, Jul 2008]
• Molecular Mass: 53.1 kDa
• AA Sequence: MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCANP1 dendritic cell associated nuclear protein [ Homo sapiens (human) ]
• Official Symbol: DCANP1
• Synonyms: DCANP1; dendritic cell associated nuclear protein; C5ORF20; chromosome 5 open reading frame 20; dendritic cell nuclear protein 1; DCNP1
• Gene ID: 140947
• mRNA Refseq: NM_130848
• Protein Refseq: NP_570900
• MIM: 609710
• UniProt ID: Q8TF63