Recombinant Human CYTH3 Protein, GST-tagged

• Cat.No.: CYTH3-2305H
• Product Overview: Human CYTH3 full-length ORF (AAH08191.1, 1 a.a. - 179 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq, Jul 2008]
• Molecular Mass: 45.43 kDa
• AA Sequence: MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYTH3 cytohesin 3 [ Homo sapiens ]
• Official Symbol: CYTH3
• Synonyms: CYTH3; cytohesin 3; pleckstrin homology, Sec7 and coiled coil domains 3 , PSCD3; cytohesin-3; ARNO3; GRP1; ARF nucleotide-binding site opener 3; general receptor of phosphoinositides 1; pleckstrin homology, Sec7 and coiled-coil domains 3; PH, SEC7 and coiled-coil domain-containing protein 3; PSCD3
• Gene ID: 9265
• mRNA Refseq: NM_004227
• Protein Refseq: NP_004218
• MIM: 605081
• UniProt ID: O43739