Recombinant Full Length Human CYTH3 Protein, GST-tagged

Cat.No. : CYTH3-2501HF
Product Overview : Human CYTH3 full-length ORF (AAH08191.1, 1 a.a. - 179 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 179 amino acids
Description : This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq, Jul 2008]
Molecular Mass : 45.43 kDa
AA Sequence : MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYTH3 cytohesin 3 [ Homo sapiens ]
Official Symbol CYTH3
Synonyms CYTH3; cytohesin 3; pleckstrin homology, Sec7 and coiled coil domains 3 , PSCD3; cytohesin-3; ARNO3; GRP1; ARF nucleotide-binding site opener 3; general receptor of phosphoinositides 1; pleckstrin homology, Sec7 and coiled-coil domains 3; PH, SEC7 and coiled-coil domain-containing protein 3; PSCD3;
Gene ID 9265
mRNA Refseq NM_004227
Protein Refseq NP_004218
MIM 605081
UniProt ID O43739

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYTH3 Products

Required fields are marked with *

My Review for All CYTH3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon