Recombinant Human CYP2E1 Protein, GST-tagged

• Cat.No.: CYP2E1-2265H
• Product Overview: Human CYP2E1 full-length ORF ( NP_000764.1, 1 a.a. - 493 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]
• Molecular Mass: 83.2 kDa
• AA Sequence: MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYP2E1 cytochrome P450 family 2 subfamily E member 1 [ Homo sapiens (human) ]
• Official Symbol: CYP2E1
• Synonyms: CYP2E1; cytochrome P450 family 2 subfamily E member 1; Cytochrome P450 Family 2 Subfamily E Member 1; Cytochrome P450, Subfamily IIE (Ethanol-Inducible), Polypeptide 1; Cytochrome P450, Family 2, Subfamily E, Polypeptide 1; 4-Nitrophenol 2-Hydroxylase; Cytochrome P450-J; CYPIIE1; CYP2E; Flavoprotein-Linked Monooxygenase; Microsomal Monooxygenase; Xenobiotic Monooxygenase; Cytochrome P450 2E1; EC 1.14.13.n7; EC 1.14.14.1; EC 1.14.13.-; P450C2E; P450-J; CPE1; cytochrome P450 2E1; 4-nitrophenol 2-hydroxylase; CYPIIE1; cytochrome P450, family 2, subfamily E, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; cytochrome P450-J; flavoprotein-linked monooxygenase; microsomal monooxygenase; xenobiotic monooxygenase; EC 1.14.13.n7
• Gene ID: 1571
• mRNA Refseq: NM_000773
• Protein Refseq: NP_000764
• MIM: 124040
• UniProt ID: P05181