Recombinant Human CYBB

Cat.No. : CYBB-30450TH
Product Overview : Recombinant fragment of Human NOX2/gp91phox with proprietary tag at the N terminal; Predicted MW 31.35 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 52 amino acids
Description : Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cells respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
Molecular Weight : 31.350kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV
Sequence Similarities : Contains 1 FAD-binding FR-type domain.Contains 1 ferric oxidoreductase domain.
Gene Name CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ]
Official Symbol CYBB
Synonyms CYBB; cytochrome b-245, beta polypeptide; CGD, chronic granulomatous disease; cytochrome b-245 heavy chain; GP91 PHOX; NOX2;
Gene ID 1536
mRNA Refseq NM_000397
Protein Refseq NP_000388
MIM 300481
Uniprot ID P04839
Chromosome Location Xp21.1
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Cross-presentation of particulate exogenous antigens (phagosomes), organism-specific biosystem;
Function contributes_to electron carrier activity; flavin adenine dinucleotide binding; heme binding; metal ion binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYBB Products

Required fields are marked with *

My Review for All CYBB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon