Recombinant Human CYBB

• Cat.No.: CYBB-30450TH
• Product Overview: Recombinant fragment of Human NOX2/gp91phox with proprietary tag at the N terminal; Predicted MW 31.35 kDa, inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 52 amino acids
• Description: Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cells respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
• Molecular Weight: 31.350kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV
• Sequence Similarities: Contains 1 FAD-binding FR-type domain.Contains 1 ferric oxidoreductase domain.

Gene Information

• Gene Name: CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ]
• Official Symbol: CYBB
• Synonyms: CYBB; cytochrome b-245, beta polypeptide; CGD, chronic granulomatous disease; cytochrome b-245 heavy chain; GP91 PHOX; NOX2
• Gene ID: 1536
• mRNA Refseq: NM_000397
• Protein Refseq: NP_000388
• MIM: 300481
• Uniprot ID: P04839
• Chromosome Location: Xp21.1
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Cross-presentation of particulate exogenous antigens (phagosomes), organism-specific biosystem
• Function: contributes_to electron carrier activity; flavin adenine dinucleotide binding; heme binding; metal ion binding; oxidoreductase activity