Recombinant Full Length Mouse Cytochrome B-245 Heavy Chain(Cybb) Protein, His-Tagged
Cat.No. : | RFL13821MF |
Product Overview : | Recombinant Full Length Mouse Cytochrome b-245 heavy chain(Cybb) Protein (Q61093) (1-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-570) |
Form : | Lyophilized powder |
AA Sequence : | MGNWAVNEGLSIFVILVWLGLNVFLFINYYKVYDDGPKYNYTRKLLGSALALARAPAACL NFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHL FNVEWCVNARVGISDRYSIALSDIGDNENEEYLNFAREKIKNPEGGLYVAVTRLAGITGI VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLEEHN LDICADKIEEWGKIKECPVPKFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL KSVWYKYCDNATSLKLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNANFLSYNIYL TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASEHPNTTIGVFLCGPE ALAETLSKQSISNSESGPRGVHFIFNKENF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cybb |
Synonyms | Cybb; Cgd; Cytochrome b-245 heavy chain; CGD91-phox; Cytochrome b(558 subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome |
UniProt ID | Q61093 |
◆ Recombinant Proteins | ||
RFL19548DF | Recombinant Full Length Danio Rerio N-Acetyltransferase 14(Nat14) Protein, His-Tagged | +Inquiry |
FAM86C1-3811H | Recombinant Human FAM86C1 Protein, GST-tagged | +Inquiry |
FCER2-27253TH | Recombinant Human FCER2 protein | +Inquiry |
CD19-3307HA | Recombinant Human CD19 protein, Fc-tagged, APC labeled | +Inquiry |
CD8A-823M | Recombinant Mouse CD8A Protein (Met1-Tyr196), His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
CLU-67H | Native Human Clusterin | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPACA7-8300HCL | Recombinant Human C13orf28 293 Cell Lysate | +Inquiry |
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
KRT6B-4866HCL | Recombinant Human KRT6B 293 Cell Lysate | +Inquiry |
VBP1-420HCL | Recombinant Human VBP1 293 Cell Lysate | +Inquiry |
C1orf31-8160HCL | Recombinant Human C1orf31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Cybb Products
Required fields are marked with *
My Review for All Cybb Products
Required fields are marked with *
0
Inquiry Basket