Recombinant Human CX3CR1 Protein, His/GST-tagged
Cat.No. : | CX3CR1-220H |
Product Overview : | Recombinant Human CX3CR1 Protein(NP_001164642.1)(Met1~Lys103), fused with N-terminal His and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | Met1~Lys103 |
Description : | Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose. |
Molecular Mass : | 42kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCK |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 90% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Concentration : | 200µg/mL |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | CX3CR1 C-X3-C motif chemokine receptor 1 [ Homo sapiens (human) ] |
Official Symbol | CX3CR1 |
Synonyms | V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1 |
Gene ID | 1524 |
mRNA Refseq | NM_001171171.2 |
Protein Refseq | NP_001164642.1 |
MIM | 601470 |
UniProt ID | P49238 |
◆ Cell & Tissue Lysates | ||
CX3CR1-7173HCL | Recombinant Human CX3CR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CX3CR1 Products
Required fields are marked with *
My Review for All CX3CR1 Products
Required fields are marked with *
0
Inquiry Basket