Recombinant Human CX3CR1 Protein, His/GST-tagged

• Cat.No.: CX3CR1-220H
• Product Overview: Recombinant Human CX3CR1 Protein(NP_001164642.1)(Met1~Lys103), fused with N-terminal His and GST tag, was expressed in E. coli.

Specification

• Description: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: His&GST
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose.
• Molecular Mass: 42kDa as determined by SDS-PAGE reducing conditions.
• Protein length: Met1~Lys103
• AA Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCK
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 90%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Concentration: 200µg/mL
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: CX3CR1 C-X3-C motif chemokine receptor 1 [ Homo sapiens (human) ]
• Official Symbol: CX3CR1
• Synonyms: V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
• Gene ID: 1524
• mRNA Refseq: NM_001171171.2
• Protein Refseq: NP_001164642.1
• MIM: 601470
• UniProt ID: P49238