Recombinant Human CX3CR1 Protein, His/GST-tagged

Cat.No. : CX3CR1-220H
Product Overview : Recombinant Human CX3CR1 Protein(NP_001164642.1)(Met1~Lys103), fused with N-terminal His and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
Source : E. coli
Species : Human
Tag : His&GST
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose.
Molecular Mass : 42kDa as determined by SDS-PAGE reducing conditions.
Protein length : Met1~Lys103
AA Sequence : MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCK
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 90%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Concentration : 200µg/mL
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name CX3CR1 C-X3-C motif chemokine receptor 1 [ Homo sapiens (human) ]
Official Symbol CX3CR1
Synonyms V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
Gene ID 1524
mRNA Refseq NM_001171171.2
Protein Refseq NP_001164642.1
MIM 601470
UniProt ID P49238

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CX3CR1 Products

Required fields are marked with *

My Review for All CX3CR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon