Recombinant Full Length Mouse Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged

• Cat.No.: RFL26790MF
• Product Overview: Recombinant Full Length Mouse CX3C chemokine receptor 1(Cx3cr1) Protein (Q9Z0D9) (1-354aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Mus musculus (Mouse)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-354)
• AA Sequence: MSTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSVFYALVFTFGLVGNLLVVLALTNS RKPKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFF ITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDY PEVLQEMWPVLRNSEVNILGFALPLLIMSFCYFRIIQTLFSCKNRKKARAVRLILLVVFA FFLFWTPYNIMIFLETLKFYNFFPSCDMKRDLRLALSVTETVAFSHCCLNPFIYAFAGEK FRRYLGHLYRKCLAVLCGHPVHTGFSPESQRSRQDSILSSFTHYTSEGDGSLLL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Cx3cr1
• Synonyms: Cx3cr1; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; mCX3CR1; Fractalkine receptor
• UniProt ID: Q9Z0D9