Recombinant Human CTSZ Protein, GST-tagged

• Cat.No.: CTSZ-2120H
• Product Overview: Human CTSZ full-length ORF ( NP_001327.2, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008]
• Molecular Mass: 58.96 kDa
• AA Sequence: MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTSZ cathepsin Z [ Homo sapiens ]
• Official Symbol: CTSZ
• Synonyms: CTSZ; cathepsin Z; carboxypeptidase LB; cathepsin B2; cathepsin IV; cathepsin X; cathepsin Y; cathepsin Z1; CTSX; cysteine type carboxypeptidase; lysosomal carboxypeptidase B; cathepsin P; preprocathepsin P; cysteine-type carboxypeptidase; FLJ17088
• Gene ID: 1522
• mRNA Refseq: NM_001336
• Protein Refseq: NP_001327
• MIM: 603169
• UniProt ID: Q9UBR2