Recombinant Rat Ctsz protein, His-SUMO-tagged

• Cat.No.: Ctsz-767R
• Product Overview: Recombinant Rat Ctsz protein(Q9R1T3)(64-306aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 64-306aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAIINHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACTFGDPIV

Gene Information

• Gene Name: Ctsz cathepsin Z [ Rattus norvegicus ]
• Official Symbol: Ctsz
• Synonyms: CTSZ; cathepsin Z; cathepsin X; cathepsin Y; CATX
• Gene ID: 252929
• mRNA Refseq: NM_183330
• Protein Refseq: NP_899159