Recombinant Human CSE1L

Cat.No. : CSE1L-27953TH
Product Overview : Recombinant full length Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 47.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 195 amino acids
Description : Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.
Molecular Weight : 47.520kDa inclusive of tags
Tissue specificity : Highly expressed in proliferating cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW
Sequence Similarities : Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain.
Gene Name CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ]
Official Symbol CSE1L
Synonyms CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2;
Gene ID 1434
mRNA Refseq NM_001316
Protein Refseq NP_001307
MIM 601342
Uniprot ID P55060
Chromosome Location 20q13
Pathway Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem;
Function importin-alpha export receptor activity; protein binding; protein transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSE1L Products

Required fields are marked with *

My Review for All CSE1L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon