Recombinant Human CRTC3 protein, GST-tagged

• Cat.No.: CRTC3-32H
• Product Overview: Recombinant Human CRTC3(176 a.a. - 274 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 176-274 a.a.
• Description: This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: QDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGN AFPHNGQNLGLSPFLGTLNTGGSL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CRTC3 CREB regulated transcription coactivator 3 [ Homo sapiens ]
• Official Symbol: CRTC3
• Synonyms: CRTC3; CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; FLJ21868; TORC-3; transducer of CREB protein 3; transducer of regulated CREB protein 3; transducer of regulated cAMP response element-binding protein 3; transducer of regulated cAMP response element-binding protein (CREB) 3; TORC3
• Gene ID: 64784
• mRNA Refseq: NM_022769
• Protein Refseq: NP_073606
• MIM: 608986
• UniProt ID: Q6UUV7
• Chromosome Location: 15q26.1
• Pathway: HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: cAMP response element binding protein binding