Recombinant Human CREBBP protein, GST-tagged

• Cat.No.: CREBBP-194H
• Product Overview: Recombinant Human CREBBP(a.a: 1081–1197) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: 40 mM Tris-HCl pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20 and 20% glycerol.
• Molecular Mass: 41 kDa
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRY IADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHV THPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLE VLFQGPLGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
• Purity: > 96%
• Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
• Storage: >6 months at –80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.23 mg/ml

Gene Information

• Gene Name: CREBBP CREB binding protein [ Homo sapiens ]
• Official Symbol: CREBBP
• Synonyms: CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS
• Gene ID: 1387
• mRNA Refseq: NM_004380
• Protein Refseq: NP_004371
• MIM: 600140
• UniProt ID: Q92793
• Chromosome Location: 16p13.3
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Angiogenesis, organism-specific biosystem; BMAL1:CLOCK/NPAS2 Activates Circadian Expression, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell cycle, organism-specific biosystem