Recombinant Human CRADD Protein

Description :	This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with mental retardation. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants.
Source :	E. coli
Form :	Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass :	23kD
AA Sequence :	GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Tag :	Non

Gene Name	CRADD CASP2 and RIPK1 domain containing adaptor with death domain [ Homo sapiens ]
Official Symbol	CRADD
Synonyms	CRADD; CASP2 and RIPK1 domain containing adaptor with death domain; death domain-containing protein CRADD; RAIDD; RIP associated ICH1/CED3 homologous protein with death domain; death adaptor molecule RAIDD; caspase and RIP adaptor with death domain; RIP-associated protein with a death domain; RIP-associated ICH1/CED3-homologous protein with death domain; MRT34; MGC9163;
Gene ID	8738
mRNA Refseq	NM_003805
Protein Refseq	NP_003796
MIM	603454
UniProt ID	P78560