Recombinant Human CRADD protein, His-SUMO-tagged

• Cat.No.: CRADD-2731H
• Product Overview: Recombinant Human CRADD protein(P78560)(1-199aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-199aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.7 kDa
• AA Sequence: MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CRADD CASP2 and RIPK1 domain containing adaptor with death domain [ Homo sapiens ]
• Official Symbol: CRADD
• Synonyms: CRADD; CASP2 and RIPK1 domain containing adaptor with death domain; death domain-containing protein CRADD; RAIDD; RIP associated ICH1/CED3 homologous protein with death domain; death adaptor molecule RAIDD; caspase and RIP adaptor with death domain; RIP-associated protein with a death domain; RIP-associated ICH1/CED3-homologous protein with death domain; MRT34; MGC9163
• Gene ID: 8738
• mRNA Refseq: NM_003805
• Protein Refseq: NP_003796
• MIM: 603454
• UniProt ID: P78560