Recombinant Human CR1 protein, GST-tagged

• Cat.No.: CR1-2726H
• Product Overview: Recombinant Human CR1 protein(P17927)(41-234aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.4 kDa
• Protein length: 41-234aa
• AA Sequence: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CR1 complement component (3b/4b) receptor 1 (Knops blood group) [ Homo sapiens ]
• Official Symbol: CR1
• Synonyms: CR1; complement component (3b/4b) receptor 1 (Knops blood group); complement component (3b/4b) receptor 1, including Knops blood group system; complement receptor type 1; CD35; KN; CD35 antigen; C3b/C4b receptor; C3-binding protein; Knops blood group antigen; complement component receptor 1; C3BR; C4BR
• Gene ID: 1378
• mRNA Refseq: NM_000573
• Protein Refseq: NP_000564
• MIM: 120620
• UniProt ID: P17927