Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged
Cat.No. : | COX4I1-419H |
Product Overview : | Recombinant Human COX4I1 Protein (23-169 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-169 aa |
Description : | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 33.2 kDa |
AA Sequence : | AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ] |
Official Symbol | COX4I1 |
Synonyms | COX4I1; COX4 1; COX IV-1; COX4; COXIV; COX4-1; FLJ23483; MGC72016; |
Gene ID | 1327 |
mRNA Refseq | NM_001861 |
Protein Refseq | NP_001852 |
MIM | 123864 |
UniProt ID | P13073 |
◆ Recombinant Proteins | ||
COX4I1-1782H | Recombinant Human COX4I1 Protein (Ala23-Lys169), N-His tagged | +Inquiry |
COX4I1-2290C | Recombinant Chicken COX4I1 | +Inquiry |
COX4I1-26361TH | Recombinant Human COX4I1 | +Inquiry |
COX4I1-1742H | Recombinant Human COX4I1 Protein, GST-tagged | +Inquiry |
COX4I1-419H | Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *
0
Inquiry Basket