Recombinant Human COX4I1 Protein, GST-tagged

• Cat.No.: COX4I1-1742H
• Product Overview: Human COX4I1 full-length ORF ( AAH08704, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
• Molecular Mass: 44.33 kDa
• AA Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ]
• Official Symbol: COX4I1
• Synonyms: COX4I1; cytochrome c oxidase subunit IV isoform 1; COX4, cytochrome c oxidase subunit IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4 1; COX IV-1; cytochrome c oxidase polypeptide IV; COX4; COXIV; COX4-1; FLJ23483; MGC72016
• Gene ID: 1327
• mRNA Refseq: NM_001861
• Protein Refseq: NP_001852
• MIM: 123864
• UniProt ID: P13073