Recombinant Human COL9A3 Protein, GST-tagged

• Cat.No.: COL9A3-1665H
• Product Overview: Human COL9A3 partial ORF ( NP_001844, 280 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. [provided by RefSeq, Jan 2010]
• Molecular Mass: 32.23 kDa
• AA Sequence: GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COL9A3 collagen, type IX, alpha 3 [ Homo sapiens ]
• Official Symbol: COL9A3
• Synonyms: COL9A3; collagen, type IX, alpha 3; collagen alpha-3(IX) chain; collagen type IX proteoglycan; DJ885L7.4.1; EDM3; FLJ90759; IDD; MED; collagen IX, alpha-3 polypeptide
• Gene ID: 1299
• mRNA Refseq: NM_001853
• Protein Refseq: NP_001844
• MIM: 120270
• UniProt ID: Q14050